PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S06525.10
Common NameJCGZ_05538, LOC105628112
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family NF-YC
Protein Properties Length: 213aa    MW: 24565.8 Da    PI: 10.4682
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S06525.10genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC31.92.8e-101141941898
          NF-YC  18 nhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98 
                      ++P+arik+i+  +e   ++  ++  l+ ka e fi ++    +  +   ++++l    ++++v +   fdfl d vp 
  Jcr4S06525.10 114 TFRFPMARIKRIITREESGLQLNQDVVFLVNKATEKFIQQFCEEGYDCSVRDRKKSLGYKHLSSVVREQRRFDFLSDFVPD 194
                    4579***************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008084.4E-13116179IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.101.7E-20117193IPR009072Histone-fold
SuperFamilySSF471132.35E-15133195IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MASTKKSKNE EDKKKKRIKV VASTKSPKQE KNKDKKKKKK QNNTANGTTR RSESLDVMVI  60
SSSSCGSQES EEETVKRSET KKRSITSTNR TKKSNSKRKE QAEEDNEEGE AEITFRFPMA  120
RIKRIITREE SGLQLNQDVV FLVNKATEKF IQQFCEEGYD CSVRDRKKSL GYKHLSSVVR  180
EQRRFDFLSD FVPDKLNAQD ALAQMKLLET RQG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012064845.11e-153PREDICTED: DNA polymerase epsilon subunit C isoform X2
TrEMBLA0A067L6H21e-153A0A067L6H2_JATCU; Uncharacterized protein
STRINGPOPTR_0009s01750.11e-46(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120163031
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07980.12e-32nuclear factor Y, subunit C10
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]